PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG001900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 927aa    MW: 101253 Da    PI: 5.0913
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG001900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-185096148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  Pavir.5NG001900.1.p 50 KGNWTPEEDAILSRAVQTYQGKNWKKIAECFP-DRTDVQCLHRWQKVL 96
                         79******************************.************986 PP

2Myb_DNA-binding62.11.1e-19102148148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          +g+W++eEde++v+ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  Pavir.5NG001900.1.p 102 KGPWSKEEDEIIVQMVNKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                          79******************************.*************97 PP

3Myb_DNA-binding47.34.7e-15154196145
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  Pavir.5NG001900.1.p 154 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 196
                          579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6774596IPR017930Myb domain
SuperFamilySSF466896.21E-1948110IPR009057Homeodomain-like
SMARTSM007173.1E-174998IPR001005SANT/Myb domain
PfamPF002493.7E-165096IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2451104IPR009057Homeodomain-like
CDDcd001676.29E-155296No hitNo description
PROSITE profilePS5129431.9297152IPR017930Myb domain
SuperFamilySSF466892.23E-3199195IPR009057Homeodomain-like
SMARTSM007171.5E-18101150IPR001005SANT/Myb domain
CDDcd001672.68E-16104148No hitNo description
Gene3DG3DSA:1.10.10.604.7E-27105151IPR009057Homeodomain-like
PfamPF139213.0E-18105165No hitNo description
Gene3DG3DSA:1.10.10.607.0E-21152203IPR009057Homeodomain-like
PROSITE profilePS5129419.654153203IPR017930Myb domain
SMARTSM007174.4E-14153201IPR001005SANT/Myb domain
CDDcd001676.46E-11156196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 927 aa     Download sequence    Send to blast
MASDKAKVAK KGGEDPGLPP ASREGENSHE PQRQRSLNGR TTGPTRRSTK GNWTPEEDAI  60
LSRAVQTYQG KNWKKIAECF PDRTDVQCLH RWQKVLNPEL VKGPWSKEED EIIVQMVNKY  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP AINKEAWTQE EEITLIHAHR MYGNKWAELT  180
KFLPGRTDNA IKNHWNSSVK KKVDSYISSG LLSQVPCLPV IECPAQCNSL SAMNLQNIGD  240
SGCNAHNTNV ALSCELQVNV DDNKGEAHDS HSSMCQGACY TSVEAVGSAL PDGHHHLSSS  300
FSQRMDLQMD VNEGSGNSVF ADDQTLCSTS NQEKSMVPYG VAEEMPVSVL STVSDAEQKL  360
HLNSDADSLK SELWRDVSLQ TLISGDTIDG DSSSGLNQLP DTSEMDTNLL AQPYPLHSSN  420
PSSVMETVYE QNSLPTVSPS FICLDSLSDA PKNRSEPVEM PDSEADMITC SNSSFCDVEQ  480
SAKPGSSDDR PGAFTISESI TNCRSQQSTD AEEPVASTAK EQLPKDMDIV PDEKKGGGAL  540
FYEPPRFPGL DVPFISCDLV TSADMQEFSP LGIRQWMRST MNVPTPLRLW GSPTHDESPG  600
VLKSAAESFP CTPSIMKKRQ RGLLSPTPDK RIEKKSGIAK EMTDISYMIA ATCSMNATKD  660
EATSPESVAC AEQHSSFKHL DEKLEFSDGN RENFNGAPEQ VRDAQNGGNK QGGQKCSSLN  720
VANPNTDLPD NLQPVGILVE HNCNDIIAAD PESLSSCKEA VSSKPKPAAL VVEKSSPCIN  780
ADYEYVNLLA DTPGVKRGLE SPSAWKSPWY IDMHMHFQGF VSPADRTYDA LGLVKQISKR  840
SAAAAVEACE VLASGSRISD KENKENRDDK EPGTRQSQTK IMAEARVLDF DEYSTPAKAA  900
DKRLGSCLGK SVSSPILSSP NMRCFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-67502036159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-67502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.184430.0stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967414.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLK3XEN20.0K3XEN2_SETIT; Uncharacterized protein
STRINGSi000349m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-103myb domain protein 3r-4